Noggin Human Recombinant
Noggin Human Recombinant produced in E.Coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa).
Noggin is purified by proprietary chromatographic techniques.
Accession
Amino acid sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGH
YDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPS
EIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDL
GSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQR
RGQRCGWIPIQYPIISECKCSC.
Biological Activity
The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 ug/ml of Noggin concentration corresponding to a Specific Activity of 12.5-20MIU/mg
Formulation
Lyophilized from a 0.2um filtered solution in 30% CH3CN, 0.1% TFA.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Protein content
Protein quantitation was carried out by two independent methods:
1. UV spectroscopy at 280 nm using the absorbency value of 1.76 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of Noggin as a Reference Standard.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Solubility
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
Source
Stability
Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution Noggin should be stored at 4oC between 2-7 days and for future use below
-18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Synonyms
