NAD (P) H-hydrate epim-->

Request QuoteCatalog Number: xP520712LMGSize: 0.2-1mg

Recombinant NAD (P) H-hydrate epimerase

Recombinant NAD (P) H-hydrate epimerase can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP520712LMG	Yeast	1mg	Quote
EP520712LMG	E. coli	1mg	Quote
BP520712LMG	Baculovirus	200ug	Quote
MP520712LMG	Mammalian Cell	200ug	Quote

Protein Information

Species	Lactobacillus buchneri (strain NRRL B-30929)
UniProt ID	F4FTW6
Gene Name	nnrE; Locus:Lbuc_1950
Protein Name	NAD (P) H-hydrate epimerase
Region Expressed	1-215
Expression Tag	6xHis
Purity	>90%
AA Sequence	MTQAITVEESRELDDKTINKIGIPSLVLMERAGLKIYENMLDNKDLDLSNVLILAGTGNN GGDGLVVARLLATHGYQVSILTVGNPDHASEDHLAQARICNYYQIPKVFMNADFNKFTTL VDALFGSGLSRNVGGDFATIIDKANASTAKIHAIDIPSGLNGDTGDVMGTAIKAISTSTV AYPKVGMLKDQAKPYTGKIYVDDIGIYRGNAFENE
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products