NAD (P) H-hydrate epi-->

Request QuoteCatalog Number: xP531061RASize: 0.2-1mg

Recombinant NAD (P) H-hydrate epimerase

Recombinant NAD (P) H-hydrate epimerase can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP531061RA	Yeast	1mg	Quote
EP531061RA	E. coli	1mg	Quote
BP531061RA	Baculovirus	200ug	Quote
MP531061RA	Mammalian Cell	200ug	Quote

Protein Information

Species	Rattus norvegicus (Rat)
UniProt ID	B0BNM1
Gene Name	Apoa1bp; aka: Aibp
Protein Name	NAD (P) H-hydrate epimerase
Region Expressed	54-282
Expression Tag	6xHis
Purity	>90%
AA Sequence	LSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGN NGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDEL YELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLI SLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVYRLQ
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products