Request QuoteCatalog Number: xP001046EKMSize: 0.2-1mg

Request Quote

Recombinant Multidrug resistance protein 1 (MDR1)

Recombinant Multidrug resistance protein 1 (MDR1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001046EKMYeast1mgYP001046EKM
EP001046EKME. coli1mgQuote
BP001046EKMBaculovirus200ugQuote
MP001046EKMMammalian Cell200ugQuote

Protein Information

SpeciesEntamoeba histolytica
UniProt IDP16875
Gene NameMDR1
Protein NameMultidrug resistance protein 1
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceSGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENI MLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review