Request QuoteCatalog Number: xP004779HUSize: 0.2-1mg

Request Quote

Recombinant C-C motif chemokine 16 (CCL16)

Recombinant C-C motif chemokine 16 (CCL16) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP004779HUYeast1mgQuote
EP004779HUE. coli1mgRPB126Hu01; EP004779HU
BP004779HUBaculovirus200ugQuote
MP004779HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO15467
Gene NameCCL16; aka: ILINCK, NCC4, SCYA16
Protein NameC-C motif chemokine 16
Region Expressed24-120
Expression Tag6xHis
Purity>90%
AA SequenceQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDW VQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review