MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN
GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE
EAAMELKVEDPFYWVSPGHHHHHH.

The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

5-20ug per ml for In-Vitro Experiments and 50-100ug per animal for In-Vivo study.
The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, western blotting, ELISA and EAE induction in mice.

It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Escherichia Coli.

Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution MOG should be stored at 4^oC between 2-7 days and for future use below
-18^oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

Q16653