Request QuoteCatalog Number: xP509828SVNSize: 0.2-1mg

Request Quote

Recombinant Mitochondrial zinc maintenance protein 1, mitochondrial (MZM1)

Recombinant Mitochondrial zinc maintenance protein 1, mitochondrial (MZM1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509828SVNYeast1mgQuote
EP509828SVNE. coli1mgQuote
BP509828SVNBaculovirus200ugQuote
MP509828SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8Z651
Gene NameMZM1; aka: AIM8, FMP36; ORFs:EC1118_1D0_8075g
Protein NameMitochondrial zinc maintenance protein 1, mitochondrial
Region Expressed25-123
Expression Tag6xHis
Purity>90%
AA SequenceDAEVLLAARAKMRSGMLCPPDPKLTTEDQIQHLEDVAVFLRRNLVQGKKVDGSSTKEPRY HLNIHKDTELGDNETIADPTARVKTNLKARPFKCSDKKQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review

Products