TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDS
ADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.
Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution CXCL9 should be stored at 4oC between 2-7 days and for future use below -18oC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Small inducible cytokine B9, CXCL9, Gamma interferon-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-interferon.
Aprotinin Bovine$148.20
