MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM
AFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVY
INYYDMNAANVGWNNSTFA.
Human MIF biological activity was measured in an agarose microdroplet assay usinghuman U937 cells astargets.The optimal range of activity found for human MIF in this assay was 500-1,000ng/ml corresponding to a specific activity of 1,000-2,000IU/mg.
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution MIF-protein should be stored at 4oC between 2-7 days and for future use below -18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
