Mast cell protease -->

Request QuoteCatalog Number: xP337398MOSize: 0.2-1mg

Recombinant Mast cell protease 8 (Mcpt8)

Recombinant Mast cell protease 8 (Mcpt8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP337398MO	Yeast	1mg	Quote
EP337398MO	E. coli	1mg	Quote
BP337398MO	Baculovirus	200ug	Quote
MP337398MO	Mammalian Cell	200ug	Quote

Protein Information

Species	Mus musculus (Mouse)
UniProt ID	P43430
Gene Name	Mcpt8
Protein Name	Mast cell protease 8
Region Expressed	21-247
Expression Tag	6xHis
Purity	>90%
AA Sequence	IIWGTESKPHSRPYMAYIRFNDSKSVYRCGGFLVARDIVMTAAHCNGKVINVTLGIHNLK KKKNTQLIPVSEAIPHESFDNETLVNDIMLLKLERKAQLNSAVDTIALPKSKDWVKPGQV CTVAGWGKLANCTLSDTLQEVNLEVQKGQKCRSMSQTYNDSIQLCVGNPSENKATGKGDS GGPFVCNGVVQGIVSCRLCTGTLPRVFTRISSFMPWIRKTMKLLQQP
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products