Request QuoteCatalog Number: xP333994MOSize: 0.2-1mg

Request Quote

Recombinant Lymphocyte antigen 6G (Ly6g)

Recombinant Lymphocyte antigen 6G (Ly6g) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP333994MOYeast1mgQuote
EP333994MOE. coli1mgQuote
BP333994MOBaculovirus200ugQuote
MP333994MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP35461
Gene NameLy6g
Protein NameLymphocyte antigen 6G
Region Expressed4-96
Expression Tag6xHis
Purity>90%
AA SequenceLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTE ITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review