Request QuoteCatalog Number: xP510633FIMSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (LCL2)

Recombinant Long chronological lifespan protein 2 (LCL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510633FIMYeast1mgQuote
EP510633FIME. coli1mgQuote
BP510633FIMBaculovirus200ugQuote
MP510633FIMMammalian Cell200ugQuote

Protein Information

SpeciesSordaria macrospora (strain ATCC MYA-333 / DSM 997 / K (L3346) / K-hell)
UniProt IDD1ZMX7
Gene NameLCL2; ORFs:SMAC_07951
Protein NameLong chronological lifespan protein 2
Region Expressed20-133
Expression Tag6xHis
Purity>90%
AA SequenceQFGSFFDQMFGGGGHGGHGHQHQQQHQGHGQQQHPNVPSDPSIYQANYQRAHCDKYLCPD TLACVHYPHHCPCPWPSHEDKVELAEGQRVCVSRGGFKAGEAARKIELARQGLL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review