Request QuoteCatalog Number: xP509835SVNSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (LCL2)

Recombinant Long chronological lifespan protein 2 (LCL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509835SVNYeast1mgQuote
EP509835SVNE. coli1mgQuote
BP509835SVNBaculovirus200ugQuote
MP509835SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZD75
Gene NameLCL2; ORFs:EC1118_1L10_1849g
Protein NameLong chronological lifespan protein 2
Region Expressed25-131
Expression Tag6xHis
Purity>90%
AA SequenceFFNFGHHQQQQQQQQQSYEDQVLNNPCDGYLCPDTLTCVAQQKDCPCPFPKSQLKCVLPD NKFVCISKPATHNEKFRAIYDDPVKGPKAKNKGFRDCGWVSDAYKNH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review