Request QuoteCatalog Number: xP522232DYLSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (LCL2)

Recombinant Long chronological lifespan protein 2 (LCL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522232DYLYeast1mgQuote
EP522232DYLE. coli1mgQuote
BP522232DYLBaculovirus200ugQuote
MP522232DYLMammalian Cell200ugQuote

Protein Information

SpeciesCryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)
UniProt IDE6R3N7
Gene NameLCL2; Locus:CGB_D3360W
Protein NameLong chronological lifespan protein 2
Region Expressed19-125
Expression Tag6xHis
Purity>90%
AA SequenceQFGHFFQQGFPFGGGFQQQQQQQEQHAPGRQHKGWTESERVHCRAGYVCPASLACVPTPA DCPCPYPEDIKCVIPDNRPRDEGEGPPFVCVRGDTGCAQVLEFSKPI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review