Request QuoteCatalog Number: xP517198LOPSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (LCL2)

Recombinant Long chronological lifespan protein 2 (LCL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517198LOPYeast1mgQuote
EP517198LOPE. coli1mgQuote
BP517198LOPBaculovirus200ugQuote
MP517198LOPMammalian Cell200ugQuote

Protein Information

SpeciesLeptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam)
UniProt IDE5A960
Gene NameLCL2; ORFs:Lema_P013310.1
Protein NameLong chronological lifespan protein 2
Region Expressed21-122
Expression Tag6xHis
Purity>90%
AA SequenceQFGFFDQMFGGGGGGGQQQQQPQNVRSDSVWYQQQYEAAQCSHYLCPGTLSCVHFPHHCP CAWEGVEEKIELGEGIAICASKGGWAEGEFAKKVELARKGML
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review