Request QuoteCatalog Number: xP517188FHSSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (lcl2)

Recombinant Long chronological lifespan protein 2 (lcl2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517188FHSYeast1mgQuote
EP517188FHSE. coli1mgQuote
BP517188FHSBaculovirus200ugQuote
MP517188FHSMammalian Cell200ugQuote

Protein Information

SpeciesPyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres)
UniProt IDE3RT14
Gene Namelcl2; ORFs:PTT_12117
Protein NameLong chronological lifespan protein 2
Region Expressed20-129
Expression Tag6xHis
Purity>90%
AA SequenceQFGFFDQMFGGNGGQQQQQGHHHHHEQQEAQNVRSDSSWYQSQYEGAQCTHYLCPGTLSC VHFPHHCPCAWEAVEDKVELGDGIAICGSKGGWVAGEFEKKVEMARKGLL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review