Request QuoteCatalog Number: xP515207DVFSize: 0.2-1mg

Request Quote

Recombinant Long chronological lifespan protein 2 (LCL2)

Recombinant Long chronological lifespan protein 2 (LCL2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515207DVFYeast1mgQuote
EP515207DVFE. coli1mgQuote
BP515207DVFBaculovirus200ugQuote
MP515207DVFMammalian Cell200ugQuote

Protein Information

SpeciesColletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus) (Glomerella graminicola)
UniProt IDE3QVL2
Gene NameLCL2; ORFs:GLRG_10044
Protein NameLong chronological lifespan protein 2
Region Expressed21-120
Expression Tag6xHis
Purity>90%
AA SequenceQFGFFDQMFGGQQQQQQQPQNVPSDPSQYQQRYDGSYCENYLCPDTLACVHFPHHCPCPW PANQDKFELTEGSSRICVSKGGFAAGEAARKVELARKGLL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review