Request QuoteCatalog Number: xP336047PISize: 0.2-1mg

Request Quote

Recombinant Leukocyte cysteine proteinase inhibitor 1

Recombinant Leukocyte cysteine proteinase inhibitor 1 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP336047PIYeast1mgQuote
EP336047PIE. coli1mgQuote
BP336047PIBaculovirus200ugQuote
MP336047PIMammalian Cell200ugQuote

Protein Information

SpeciesSus scrofa (Pig)
UniProt IDP35479
Gene Name
Protein NameLeukocyte cysteine proteinase inhibitor 1
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMESEEMLAGGLTEPRPATPEIQEIANKVKPQLEEKTNKTYEKFEAIIYRSQVVAGTNYYI KVHVGGNNYVHIRVFQSLPHQEDPLKLIGYQVDKTKDDELTGF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review