Request QuoteCatalog Number: xP525538RASize: 0.2-1mg

Request Quote

Recombinant Leukocyte cell-derived chemotaxin 1 (Lect1)

Recombinant Leukocyte cell-derived chemotaxin 1 (Lect1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP525538RAYeast1mgQuote
EP525538RAE. coli1mgQuote
BP525538RABaculovirus200ugQuote
MP525538RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDO70367
Gene NameLect1; aka: Chmi
Protein NameLeukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein
Region Expressed215-334
Expression Tag6xHis
Purity>90%
AA SequenceEVVRSSAPSTTRRPHSEPRGNAGPGRLSNRTRPSVQDDEEPFNPDNPYHQQEGESMTFDP RLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review