Request QuoteCatalog Number: xP392297RASize: 0.2-1mg

Request Quote

Recombinant Killer cell lectin-like receptor subfamily B member 1B allele A (Klrb1b)

Recombinant Killer cell lectin-like receptor subfamily B member 1B allele A (Klrb1b) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP392297RAYeast1mgQuote
EP392297RAE. coli1mgQuote
BP392297RABaculovirus200ugQuote
MP392297RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDA4KWA1
Gene NameKlrb1b; aka: Nkrp1b
Protein NameKiller cell lectin-like receptor subfamily B member 1B allele A
Region Expressed67-223
Expression Tag6xHis
Purity>90%
AA SequenceQKPLIQNSPADVQENRTKTTDSPAKLKCPKDWHSHQDKCFHVSQTSITWKGSLADCGGKG ATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDEKWKWINGSTLNSDALNITGDTEK DSCASVSQDKVLSESCDSDNIWICQKELKRESTCNDS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review