Request QuoteCatalog Number: xP351013MOSize: 0.2-1mg

Request Quote

Recombinant Kidney androgen-regulated protein (Kap)

Recombinant Kidney androgen-regulated protein (Kap) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP351013MOYeast1mgQuote
EP351013MOE. coli1mgQuote
BP351013MOBaculovirus200ugQuote
MP351013MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP61110
Gene NameKap
Protein NameKidney androgen-regulated protein
Region Expressed19-121
Expression Tag6xHis
Purity>90%
AA SequenceFPLSELVSINKELQNSIIDLLNSVFDQLGSYRGTKAPLEDYTDDDLSTDSEQIMDFTPAA NKQNSEFSTDVETVSSGFLEEFTENTDITVKIPLAGNPVSPTS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review