3-isopropylmalate de-->

Request QuoteCatalog Number: xP502474FPBSize: 0.2-1mg

Recombinant 3-isopropylmalate dehydratase small subunit (leuD)

Recombinant 3-isopropylmalate dehydratase small subunit (leuD) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP502474FPB	Yeast	1mg	Quote
EP502474FPB	E. coli	1mg	Quote
BP502474FPB	Baculovirus	200ug	Quote
MP502474FPB	Mammalian Cell	200ug	Quote

Protein Information

Species	Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
UniProt ID	C3MKR6
Gene Name	leuD; Locus:LS215_0288
Protein Name	3-isopropylmalate dehydratase small subunit
Region Expressed	1-165
Expression Tag	6xHis
Purity	>90%
AA Sequence	MIIEGPVIKFGDKIDTDIIIPARYLKYTDPQYLAQHVMEPLDPEFYKKASKGVIIVAGKV FGMGSSREQAAIALKAAGVKAVVAESFARIFYRNAINNGLPVITLPNSTKEIDENSYVKI DVETGEILVGNKVLKGKGITGMALEILQAGGIMEYLKKMQTVNRN
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products