Interferon tau-1 (IF-->

Request QuoteCatalog Number: xP322795BOSize: 0.2-1mg

Recombinant Interferon tau-1 (IFNT1)

Recombinant Interferon tau-1 (IFNT1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP322795BO	Yeast	1mg	Quote
EP322795BO	E. coli	1mg	Quote
BP322795BO	Baculovirus	200ug	Quote
MP322795BO	Mammalian Cell	200ug	Quote

Protein Information

Species	Bos taurus (Bovine)
UniProt ID	P15696
Gene Name	IFNT1
Protein Name	Interferon tau-1
Region Expressed	24-195
Expression Tag	6xHis
Purity	>90%
AA Sequence	CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEM LQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTV KKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products