RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR
EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution IL17F should be stored at 4oC between 2-7 days and for future use below -18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please avoid multiple freeze-thaw cycles.
Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.
