VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSND
KIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKT
KVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
The ED50 range= 0.2-0.5 ng/ml corresponding to a specific activity of 2-5MIU/mg determined by the dose dependent proliferation of mouse D10S cells.
The protein was lyophilized without any additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Protein quantitation was carried out by two independent methods
1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
Greater than 95.0% as determined by SDS-PAGE.
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution IL1b should be stored at 4oC between 2-7 days and for future use below -18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please avoid multiple freeze-thaw cycles.
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
