$90.00Catalog Number: PYT446-2ugSize: 2ug

IL 13 Human

Interleukin-13 Human Recombinant

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.
The IL-13 is purified by proprietary chromatographic techniques.

Accession

P35225

Amino acid sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS
GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE
GRFN.

Biological Activity

The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of 1MIU/mg.

Formulation

The protein (1mg/ml) was lyophilized with 1X PBS pH-7.2.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Protein content

Protein quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard.

Purity

Greater than 95% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source

Escherichia Coli.

Stability

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution IL13 should be stored at 4oC between 2-7 days and for future use below -18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please avoid multiple freeze-thaw cycles.

Synonyms

NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Quantity

$90.00

ReviewsWrite Review