Request QuoteCatalog Number: xP324086CHSize: 0.2-1mg

Request Quote

Recombinant Ig lambda chain C region

Recombinant Ig lambda chain C region can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP324086CHYeast1mgQuote
EP324086CHE. coli1mgQuote
BP324086CHBaculovirus200ugQuote
MP324086CHMammalian Cell200ugQuote

Protein Information

SpeciesGallus gallus (Chicken)
UniProt IDP20763
Gene Name
Protein NameIg lambda chain C region
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceQPKVAPTITLFPPSKEELNEATKATLVCLINDFYPSPVTVDWVIDGSTRSGETTAPQRQS NSQYMASSYLSLSASDWSSHETYTCRVTHNGTSITKTLKRSEC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review