Request QuoteCatalog Number: xP323830HUSize: 0.2-1mg

Request Quote

Recombinant Ig kappa chain V-III region HAH

Recombinant Ig kappa chain V-III region HAH can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP323830HUYeast1mgQuote
EP323830HUE. coli1mgQuote
BP323830HUBaculovirus200ugQuote
MP323830HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP18135
Gene Name
Protein NameIg kappa chain V-III region HAH
Region Expressed21-129
Expression Tag6xHis
Purity>90%
AA SequenceEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPRTFGQGTKVEIKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review