Request QuoteCatalog Number: xP324717MOSize: 0.2-1mg

Request Quote

Recombinant Ig heavy chain V region 1B43

Recombinant Ig heavy chain V region 1B43 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP324717MOYeast1mgQuote
EP324717MOE. coli1mgQuote
BP324717MOBaculovirus200ugQuote
MP324717MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP18532
Gene Name
Protein NameIg heavy chain V region 1B43
Region Expressed19-116
Expression Tag6xHis
Purity>90%
AA SequenceDVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSGNTSY NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review