Request QuoteCatalog Number: xP521832BRJSize: 0.2-1mg

Request Quote

Recombinant 5-hydroxyisourate hydrolase (pucM)

Recombinant 5-hydroxyisourate hydrolase (pucM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP521832BRJYeast1mgQuote
EP521832BRJE. coli1mgQuote
BP521832BRJBaculovirus200ugQuote
MP521832BRJMammalian Cell200ugQuote

Protein Information

SpeciesBacillus subtilis (strain 168)
UniProt IDO32142
Gene NamepucM; aka: yunM; Locus:BSU32460
Protein Name5-hydroxyisourate hydrolase
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceMGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVM EFHAGDYFASKNMNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review