Request QuoteCatalog Number: xP308485HUSize: 0.2-1mg

Request Quote

Recombinant Hydroxyacyl-thioester dehydratase type 2, mitochondrial (RPP14)

Recombinant Hydroxyacyl-thioester dehydratase type 2, mitochondrial (RPP14) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP308485HUYeast1mgQuote
EP308485HUE. coli1mgQuote
BP308485HUBaculovirus200ugQuote
MP308485HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP86397
Gene NameRPP14
Protein NameHydroxyacyl-thioester dehydratase type 2, mitochondrial
Region Expressed41-146
Expression Tag6xHis
Purity>90%
AA SequenceRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTIVHGVLINGLISALLGTKM PGPGCVFLSQEISFPAPLYIGEVVLASAEVKKLKRFIAIIAVSCSV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review