HLA class I histoco-->

Request QuoteCatalog Number: xP341155HUSize: 0.2-1mg

Recombinant HLA class I histocompatibility antigen, Cw-12 alpha chain (HLA-C)

Recombinant HLA class I histocompatibility antigen, Cw-12 alpha chain (HLA-C) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP341155HU	Yeast	1mg	Quote
EP341155HU	E. coli	1mg	Quote
BP341155HU	Baculovirus	200ug	Quote
MP341155HU	Mammalian Cell	200ug	Quote

Protein Information

Species	Homo sapiens (Human)
UniProt ID	P30508
Gene Name	HLA-C; aka: HLAC
Protein Name	HLA class I histocompatibility antigen, Cw-12 alpha chain
Region Expressed	25-308
Expression Tag	6xHis
Purity	>90%
AA Sequence	CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYW DRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDG KDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQ RAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGT FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products