Request QuoteCatalog Number: xP351645HUSize: 0.2-1mg

Request Quote

Recombinant HERV-K_19q12 provirus Rec protein

Recombinant HERV-K_19q12 provirus Rec protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP351645HUYeast1mgQuote
EP351645HUE. coli1mgQuote
BP351645HUBaculovirus200ugQuote
MP351645HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP61572
Gene Name
Protein NameHERV-K_19q12 provirus Rec protein
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLA TKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIENGP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review