Request QuoteCatalog Number: xP513948EOMSize: 0.2-1mg

Request Quote

Recombinant Heat-labile enterotoxin B chain (eltB)

Recombinant Heat-labile enterotoxin B chain (eltB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513948EOMYeast1mgQuote
EP513948EOME. coli1mgQuote
BP513948EOMBaculovirus200ugQuote
MP513948EOMMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli O78:H11 (strain H10407 / ETEC)
UniProt IDD0Z6T1
Gene NameeltB; aka: ltpB; Locus:ETEC_p666_0650
Protein NameHeat-labile enterotoxin B chain
Region Expressed22-124
Expression Tag6xHis
Purity>90%
AA SequenceAPQSITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDS QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review