Request QuoteCatalog Number: xP407376HUSize: 0.2-1mg

Request Quote

Recombinant Glutaredoxin-like protein C5orf63 (C5orf63)

Recombinant Glutaredoxin-like protein C5orf63 (C5orf63) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP407376HUYeast1mgQuote
EP407376HUE. coli1mgQuote
BP407376HUBaculovirus200ugQuote
MP407376HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA6NC05
Gene NameC5orf63
Protein NameGlutaredoxin-like protein C5orf63
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRFIL QEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQLLKLEQQSTGG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review