Request QuoteCatalog Number: xP009018RASize: 0.2-1mg

Request Quote

Recombinant Follitropin subunit beta (Fshb)

Recombinant Follitropin subunit beta (Fshb) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009018RAYeast1mgQuote
EP009018RAE. coli1mgRPD017Ra01
BP009018RABaculovirus200ugQuote
MP009018RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP18427
Gene NameFshb
Protein NameFollitropin subunit beta
Region Expressed21-130
Expression Tag6xHis
Purity>90%
AA SequenceSCELTNITISVEKEECRFCISINTTWCEGYCYTRDLVYKDPARPNTQKVCTFKELVYETI RLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review