Request QuoteCatalog Number: xP514357ENUSize: 0.2-1mg

Request Quote

Recombinant Flagellar hook-basal body complex protein FliE (fliE)

Recombinant Flagellar hook-basal body complex protein FliE (fliE) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514357ENUYeast1mgQuote
EP514357ENUE. coli1mgQuote
BP514357ENUBaculovirus200ugQuote
MP514357ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZQL1
Gene NamefliE; Locus:BWG_1742
Protein NameFlagellar hook-basal body complex protein FliE
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMSAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFT LGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review