Request QuoteCatalog Number: xP520599DOESize: 0.2-1mg

Request Quote

Recombinant N (2) -fixation sustaining protein CowN

Recombinant N (2) -fixation sustaining protein CowN can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520599DOEYeast1mgQuote
EP520599DOEE. coli1mgQuote
BP520599DOEBaculovirus200ugQuote
MP520599DOEMammalian Cell200ugQuote

Protein Information

SpeciesArcobacter nitrofigilis (strain ATCC 33309 / DSM 7299 / LMG 7604 / NCTC 12251 / CI) (Campylobacter nitrofigilis)
UniProt IDD5V2I8
Gene NamecowN; Locus:Arnit_0756
Protein NameN (2) -fixation sustaining protein CowN
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMSNFEIRVNESYESFKNIDCFENACVVIDNMLRVLENPKNMNIYWKKIVPMIPKAYYDRD PKSDTKEELLYLVCSNSFYLDELFEKAEDEQAINALSKCEQECC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review