Request QuoteCatalog Number: xP516675RLDSize: 0.2-1mg

Request Quote

Recombinant N (2) -fixation sustaining protein CowN

Recombinant N (2) -fixation sustaining protein CowN can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP516675RLDYeast1mgQuote
EP516675RLDE. coli1mgQuote
BP516675RLDBaculovirus200ugQuote
MP516675RLDMammalian Cell200ugQuote

Protein Information

SpeciesRhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
UniProt IDD5ANI6
Gene NamecowN; Locus:RCAP_rcc00575
Protein NameN (2) -fixation sustaining protein CowN
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMNDQTPDRYVTFMGIACDTNADRLCEMLAARMAGNDSRWVAYFEKKLAENAQMGHDRLRF IGAQVNALMSFFEEEDDEAALALLWHIEHHCL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review