Request QuoteCatalog Number: xP515137RLDSize: 0.2-1mg

Request Quote

Recombinant Ferredoxin-4 (fdxC)

Recombinant Ferredoxin-4 (fdxC) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515137RLDYeast1mgQuote
EP515137RLDE. coli1mgQuote
BP515137RLDBaculovirus200ugQuote
MP515137RLDMammalian Cell200ugQuote

Protein Information

SpeciesRhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
UniProt IDD5ARY7
Gene NamefdxC; aka: ptfA; Locus:RCAP_rcc03285
Protein NameFerredoxin-4
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMDKATLTFTDVSITVNVPTGTRIIEMSEKVGSGITYGCREGECGTCMTHILEGSENLSEP TALEMRVLEENLGGKDDRLACQCRVLGGAVKVRPA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review