FAD synthase (ribL) -->

Request QuoteCatalog Number: xP008710HUDSize: 0.2-1mg

Recombinant FAD synthase (ribL)

Recombinant FAD synthase (ribL) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP008710HUD	Yeast	1mg	Quote
EP008710HUD	E. coli	1mg	Quote
BP008710HUD	Baculovirus	200ug	Quote
MP008710HUD	Mammalian Cell	200ug	Quote

Protein Information

Species	Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) (Halococcus turkmenicus)
UniProt ID	D2RTP8
Gene Name	ribL; Locus:Htur_2116
Protein Name	FAD synthase
Region Expressed	1-143
Expression Tag	6xHis
Purity	>90%
AA Sequence	MTRTVIAQGTFDILHPGHVHYLEEAAAMGDELLVIVARKSNVDHKEKPICPAAQRRDVVA ALEAVDDAIVGHEEDIFAPIEAIDPDVIALGHDQHHDDDAIEAELERRGIDCTVERASAR EPEREDEILSTRLIIDRILERRG
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products