Request QuoteCatalog Number: xP007508MOVSize: 0.2-1mg

Request Quote

Recombinant Eukaryotic translation initiation factor 1b (EIF1B)

Recombinant Eukaryotic translation initiation factor 1b (EIF1B) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007508MOVYeast1mgQuote
EP007508MOVE. coli1mgQuote
BP007508MOVBaculovirus200ugQuote
MP007508MOVMammalian Cell200ugQuote

Protein Information

SpeciesMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
UniProt IDQ4R4X9
Gene NameEIF1B; ORFs:QtrA-11743
Protein NameEukaryotic translation initiation factor 1b
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review