Request QuoteCatalog Number: xP007565HUSize: 0.2-1mg

Request Quote

Recombinant Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3)

Recombinant Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007565HUYeast1mgQuote
EP007565HUE. coli1mgQuote
BP007565HUBaculovirus200ugQuote
MP007565HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO60516
Gene NameEIF4EBP3
Protein NameEukaryotic translation initiation factor 4E-binding protein 3
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCC LPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review