Request QuoteCatalog Number: xP324310GUSize: 0.2-1mg

Request Quote

Recombinant Eosinophil granule major basic protein 1 (MBP1)

Recombinant Eosinophil granule major basic protein 1 (MBP1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP324310GUYeast1mgQuote
EP324310GUE. coli1mgQuote
BP324310GUBaculovirus200ugQuote
MP324310GUMammalian Cell200ugQuote

Protein Information

SpeciesCavia porcellus (Guinea pig)
UniProt IDP22032
Gene NameMBP1
Protein NameEosinophil granule major basic protein 1
Region Expressed115-233
Expression Tag6xHis
Purity>90%
AA SequenceTRGYVMVGSARTFNEAQWVCQRCYRGNLASIHSFAFNYQVQCTSAGLNVAQVWIGGQLRG KGRCRRFVWVDRTVWNFAYWARGQPWGGRQRGRCVTLCARGGHWRRSHCGKRRPFVCTY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review