Request QuoteCatalog Number: xP007785SXVSize: 0.2-1mg

Request Quote

Recombinant Enhancer of rudimentary homolog (new10)

Recombinant Enhancer of rudimentary homolog (new10) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP007785SXVYeast1mgQuote
EP007785SXVE. coli1mgQuote
BP007785SXVBaculovirus200ugQuote
MP007785SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRN4
Gene Namenew10; ORFs:SPAC19G12.17
Protein NameEnhancer of rudimentary homolog
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMSPPPAESHIILLIQQGSDPKTRIWSDHCSLRSAIEYIVGVYQTNQAVSEKESIDVSRFF NFFDEIYDCVPLVYDRHFRAYIPHEKQWLLHHAQEYLTAARQIP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review