Q14213

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF
IATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVL
NVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQ
VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSF
ILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.

Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.

EBI3 Human Recombinant was lyophilized from a solution containig 10mM Acetic Acid and 0.5% Mannitol.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 90% as determined by

(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Escherichia Coli.

Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution EBI3 should be stored at 4^oC between 2-7 days and for future use below
-18^oC. Please prevent freeze-thaw cycles.

Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.