Request QuoteCatalog Number: xP514316DOMSize: 0.2-1mg

Request Quote

Recombinant E3 ubiquitin ligase complex SCF subunit sconC (sconC)

Recombinant E3 ubiquitin ligase complex SCF subunit sconC (sconC) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514316DOMYeast1mgQuote
EP514316DOME. coli1mgQuote
BP514316DOMBaculovirus200ugQuote
MP514316DOMMammalian Cell200ugQuote

Protein Information

SpeciesArthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
UniProt IDD4ARL8
Gene NamesconC; aka: skpA; ORFs:ARB_06761
Protein NameE3 ubiquitin ligase complex SCF subunit sconC
Region Expressed1-164
Expression Tag6xHis
Purity>90%
AA SequenceMASTATNKITLTSSDGVEVTIERQVAERSILIKNMLEDLGDSGEPIPIPNVNESVLKKVI EWCEHHKGDPPSTGDDDVDSRRKTTDIDEWDQKFMQVDQEMLFEIILAANYLDIKALLDV GCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review