Request QuoteCatalog Number: xP347112HUSize: 0.2-1mg

Request Quote

Recombinant DNA-directed RNA polymerase II subunit RPB11-a (POLR2J)

Recombinant DNA-directed RNA polymerase II subunit RPB11-a (POLR2J) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP347112HUYeast1mgQuote
EP347112HUE. coli1mgQuote
BP347112HUBaculovirus200ugQuote
MP347112HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP52435
Gene NamePOLR2J; aka: POLR2J1
Protein NameDNA-directed RNA polymerase II subunit RPB11-a
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review