Request QuoteCatalog Number: xP520445ENQSize: 0.2-1mg

Request Quote

Recombinant DNA-binding protein HU-alpha (hupA)

Recombinant DNA-binding protein HU-alpha (hupA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520445ENQYeast1mgQuote
EP520445ENQE. coli1mgQuote
BP520445ENQBaculovirus200ugQuote
MP520445ENQMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W)
UniProt IDE0J6W8
Gene NamehupA; Locus:ECW_m4359; ORFs:EschWDRAFT_4326
Protein NameDNA-binding protein HU-alpha
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review