Request QuoteCatalog Number: xP001277PISize: 0.2-1mg

Request Quote

Recombinant Disintegrin and metalloproteinase domain-containing protein 17 (ADAM17)

Recombinant Disintegrin and metalloproteinase domain-containing protein 17 (ADAM17) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001277PIYeast1mgQuote
EP001277PIE. coli1mgQuote
BP001277PIBaculovirus200ugQuote
MP001277PIMammalian Cell200ugQuote

Protein Information

SpeciesSus scrofa (Pig)
UniProt IDO77636
Gene NameADAM17; aka: TACE
Protein NameDisintegrin and metalloproteinase domain-containing protein 17
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review